Lineage for d5yt1d_ (5yt1 D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508387Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2508388Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2509060Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2509061Protein automated matches [190526] (23 species)
    not a true protein
  7. 2509413Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [267983] (2 PDB entries)
  8. 3060486Domain d5yt1d_: 5yt1 D: [360548]
    automated match to d3neda_

Details for d5yt1d_

PDB Entry: 5yt1 (more details), 2 Å

PDB Description: crystal structrure of near infrared fluoresecent protein mneptune684
PDB Compounds: (D:) near infrared fluoresecent protein mNeptune684

SCOPe Domain Sequences for d5yt1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yt1d_ d.22.1.0 (D:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
eelikenmhmklymegtvnnhhfkctsegegkpyegtqtqrikvveggplpfafdilatc
fmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvki
rgvnfpsngpvmqkktlgweantetlypadgglrghnpmalklvggghlicnlkttyrsk
kpaknlkmpgvyfvdrrlerikeadnetyveqhevavarycdlpsklg

SCOPe Domain Coordinates for d5yt1d_:

Click to download the PDB-style file with coordinates for d5yt1d_.
(The format of our PDB-style files is described here.)

Timeline for d5yt1d_:

  • d5yt1d_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22