Lineage for d6mffa1 (6mff A:1-81)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (74 PDB entries)
  8. 3060479Domain d6mffa1: 6mff A:1-81 [360541]
    Other proteins in same PDB: d6mffa2
    automated match to d5ujta1
    complexed with nag

Details for d6mffa1

PDB Entry: 6mff (more details), 2.6 Å

PDB Description: hla-dq2-glia-omega1
PDB Compounds: (A:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d6mffa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mffa1 d.19.1.0 (A:1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfal
tniavlkhnlnslikrsnsta

SCOPe Domain Coordinates for d6mffa1:

Click to download the PDB-style file with coordinates for d6mffa1.
(The format of our PDB-style files is described here.)

Timeline for d6mffa1:

  • d6mffa1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22