Lineage for d5ytab2 (5yta B:162-333)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2557171Protein automated matches [226882] (9 species)
    not a true protein
  7. 3053805Species Sus scrofa [TaxId:9823] [353867] (2 PDB entries)
  8. 3060476Domain d5ytab2: 5yta B:162-333 [360538]
    Other proteins in same PDB: d5ytaa1, d5ytab1
    automated match to d5ldha2
    complexed with nad, oxm

Details for d5ytab2

PDB Entry: 5yta (more details), 2.1 Å

PDB Description: pig heart lactate dehydrogenase in complex with nadh and oxamate
PDB Compounds: (B:) L-lactate dehydrogenase B chain

SCOPe Domain Sequences for d5ytab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ytab2 d.162.1.1 (B:162-333) automated matches {Sus scrofa [TaxId: 9823]}
sgcnldsarfrylmaeklgvhpsschgwilgehgdssvavwsgvnvagvslqelnpemgt
dndsenwkevhkmvvesayeviklkgytnwaiglsvadliesmlknlsrihpvstmvqgm
ygienevflslpcvlnargltsvinqklkddevaqlknsadtlwgiqkdlkd

SCOPe Domain Coordinates for d5ytab2:

Click to download the PDB-style file with coordinates for d5ytab2.
(The format of our PDB-style files is described here.)

Timeline for d5ytab2:

  • d5ytab2 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5ytab1