Lineage for d5ytab1 (5yta B:2-161)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844864Protein automated matches [226881] (8 species)
    not a true protein
  7. 2844936Species Pig (Sus scrofa) [TaxId:9823] [353863] (2 PDB entries)
  8. 2844942Domain d5ytab1: 5yta B:2-161 [360537]
    Other proteins in same PDB: d5ytaa2, d5ytab2
    automated match to d5ldha1
    complexed with nad, oxm

Details for d5ytab1

PDB Entry: 5yta (more details), 2.1 Å

PDB Description: pig heart lactate dehydrogenase in complex with nadh and oxamate
PDB Compounds: (B:) L-lactate dehydrogenase B chain

SCOPe Domain Sequences for d5ytab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ytab1 c.2.1.5 (B:2-161) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
atlkekliapvaeeettipnnkitvvgvgqvgmacaisilgksltdelalvdvledklkg
emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvig

SCOPe Domain Coordinates for d5ytab1:

Click to download the PDB-style file with coordinates for d5ytab1.
(The format of our PDB-style files is described here.)

Timeline for d5ytab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ytab2