Lineage for d5yt9a2 (5yt9 A:333-503)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3041844Species Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId:1490024] [359053] (4 PDB entries)
  8. 3041846Domain d5yt9a2: 5yt9 A:333-503 [360533]
    Other proteins in same PDB: d5yt9a1, d5yt9a3
    automated match to d1ha0a2
    complexed with nag; mutant

Details for d5yt9a2

PDB Entry: 5yt9 (more details), 2.77 Å

PDB Description: crystal structure of h5 hemagglutinin g228s mutant from a/chicken/taiwan/0502/2012
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5yt9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yt9a2 h.3.1.0 (A:333-503) automated matches {Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId: 1490024]}
gaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkavdgitnkvnsiiskmnsqf
eavgkefnnlerrienlnkkmedgfidvwtynaellvlmenertldlhdsnvknlydkvr
rqlrdnakelgngcfefyhrcdnkcmesvrngtydypqyseesrlkreeid

SCOPe Domain Coordinates for d5yt9a2:

Click to download the PDB-style file with coordinates for d5yt9a2.
(The format of our PDB-style files is described here.)

Timeline for d5yt9a2: