Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (42 species) not a true protein |
Species Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId:1490024] [359053] (4 PDB entries) |
Domain d5yt9a2: 5yt9 A:333-503 [360533] Other proteins in same PDB: d5yt9a1, d5yt9a3 automated match to d1ha0a2 complexed with nag; mutant |
PDB Entry: 5yt9 (more details), 2.77 Å
SCOPe Domain Sequences for d5yt9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yt9a2 h.3.1.0 (A:333-503) automated matches {Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId: 1490024]} gaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkavdgitnkvnsiiskmnsqf eavgkefnnlerrienlnkkmedgfidvwtynaellvlmenertldlhdsnvknlydkvr rqlrdnakelgngcfefyhrcdnkcmesvrngtydypqyseesrlkreeid
Timeline for d5yt9a2: