Lineage for d5yt9a1 (5yt9 A:3-323)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2371474Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2371475Protein automated matches [227017] (39 species)
    not a true protein
  7. 3058989Species Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId:1490024] [359051] (3 PDB entries)
  8. 3060470Domain d5yt9a1: 5yt9 A:3-323 [360532]
    Other proteins in same PDB: d5yt9a2
    automated match to d4we4a_
    complexed with nag; mutant

Details for d5yt9a1

PDB Entry: 5yt9 (more details), 2.77 Å

PDB Description: crystal structure of h5 hemagglutinin g228s mutant from a/chicken/taiwan/0502/2012
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5yt9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yt9a1 b.19.1.0 (A:3-323) automated matches {Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId: 1490024]}
gdricigyhannsttqvdtimeknvtvthaqdilekehngrlcslkgvkplilkncsvag
wllgnpmcdeflnapewsyivekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifpr
sswsnhdassgvssacpyngrssffrnvvwlikknnvyrtitrtynntniedlliiwgih
hpnnaaeqiklyqnpstyvsvgtstlnqrsipeiatrpkvngqssrmeffwtilrpndsi
tfestgnfiapeyaykivkkgdsaimkselsysncdtkcqtpvgainssmpfhnvhpfai
gecpkyvklkklvlatglrni

SCOPe Domain Coordinates for d5yt9a1:

Click to download the PDB-style file with coordinates for d5yt9a1.
(The format of our PDB-style files is described here.)

Timeline for d5yt9a1:

  • d5yt9a1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5yt9a2