Lineage for d5v85a_ (5v85 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2492802Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 2492803Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 2492850Family c.119.1.0: automated matches [191443] (1 protein)
    not a true family
  6. 2492851Protein automated matches [190655] (11 species)
    not a true protein
  7. 2492867Species Ruminococcus gnavus [TaxId:411470] [225774] (2 PDB entries)
  8. 3060451Domain d5v85a_: 5v85 A: [360513]
    automated match to d3jr7a_
    complexed with na, po4, vca

Details for d5v85a_

PDB Entry: 5v85 (more details), 2 Å

PDB Description: the crystal structure of the protein of degv family cog1307 from ruminococcus gnavus atcc 29149 (alternative refinement of pdb 3jr7 with vaccenic acid)
PDB Compounds: (A:) EDD domain protein, DegV family

SCOPe Domain Sequences for d5v85a_:

Sequence, based on SEQRES records: (download)

>d5v85a_ c.119.1.0 (A:) automated matches {Ruminococcus gnavus [TaxId: 411470]}
dmsykvivdscgeftpemkadggfehvalgiqiedtqwtdddslkqeelllkiaestsca
ktscpsperymesyhcdaeriyvvtlsaelsgsynsavlgknlyeeeygekqihvfnsrs
asvgetlialkvqqcekagmtfeevvesvecyieeqhtyfvlenldtlrkngrltgiksl
vagalnikpimgstpqgticqkekargmkkalvkmadcvaadvvnagdkilaiahcncee
rakevqrllkerfavkssfivdtsgistvyandggiivvv

Sequence, based on observed residues (ATOM records): (download)

>d5v85a_ c.119.1.0 (A:) automated matches {Ruminococcus gnavus [TaxId: 411470]}
dmsykvivdscgeftpemkadggfehvalgiqiedtqwtdddslkqeelllkiaestsca
ktscpsperymesyhcdaeriyvvtlsaelsgsynsavlgknlyeeeygekqihvfnsrs
asvgetlialkvqqcekagmtfeevvesvecyieeqhtyfvlenldtlrkngrltgiksa
galnikpimgstpqgticqkekargmkkalvkmadcvaadvvnagdkilaiahcnceera
kevqrllkerfavkssfivdtsgistvyandggiivvv

SCOPe Domain Coordinates for d5v85a_:

Click to download the PDB-style file with coordinates for d5v85a_.
(The format of our PDB-style files is described here.)

Timeline for d5v85a_:

  • d5v85a_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22