Lineage for d5ysub_ (5ysu B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394983Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2394984Protein automated matches [190052] (7 species)
    not a true protein
  7. 2394985Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (36 PDB entries)
  8. 3060450Domain d5ysub_: 5ysu B: [360512]
    Other proteins in same PDB: d5ysua_
    automated match to d5uwsb_
    complexed with 90r, cl, gtp, mg, na, no3

Details for d5ysub_

PDB Entry: 5ysu (more details), 2.3 Å

PDB Description: plumbagin in complex with crm1-ranm189d-ranbp1
PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d5ysub_:

Sequence, based on SEQRES records: (download)

>d5ysub_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvri
lmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskena
dkfkeefekaqeinkk

Sequence, based on observed residues (ATOM records): (download)

>d5ysub_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fepvvhktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdk
tlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkee
fekaqeinkk

SCOPe Domain Coordinates for d5ysub_:

Click to download the PDB-style file with coordinates for d5ysub_.
(The format of our PDB-style files is described here.)

Timeline for d5ysub_:

  • d5ysub_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22