Lineage for d5ytaa1 (5yta A:2-161)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2429095Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2429510Protein automated matches [226881] (7 species)
    not a true protein
  7. 3053801Species Sus scrofa [TaxId:9823] [353863] (2 PDB entries)
  8. 3060440Domain d5ytaa1: 5yta A:2-161 [360502]
    Other proteins in same PDB: d5ytaa2, d5ytab2
    automated match to d5ldha1
    complexed with nad, oxm

Details for d5ytaa1

PDB Entry: 5yta (more details), 2.1 Å

PDB Description: pig heart lactate dehydrogenase in complex with nadh and oxamate
PDB Compounds: (A:) L-lactate dehydrogenase B chain

SCOPe Domain Sequences for d5ytaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ytaa1 c.2.1.5 (A:2-161) automated matches {Sus scrofa [TaxId: 9823]}
atlkekliapvaeeettipnnkitvvgvgqvgmacaisilgksltdelalvdvledklkg
emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvig

SCOPe Domain Coordinates for d5ytaa1:

Click to download the PDB-style file with coordinates for d5ytaa1.
(The format of our PDB-style files is described here.)

Timeline for d5ytaa1:

  • d5ytaa1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5ytaa2