Lineage for d5ysua_ (5ysu A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448557Protein Ran [52609] (2 species)
  7. 2448578Species Human (Homo sapiens) [TaxId:9606] [52611] (59 PDB entries)
  8. 3060437Domain d5ysua_: 5ysu A: [360499]
    Other proteins in same PDB: d5ysub_
    automated match to d2mmca_
    complexed with 90r, cl, gtp, mg, na, no3

Details for d5ysua_

PDB Entry: 5ysu (more details), 2.3 Å

PDB Description: plumbagin in complex with crm1-ranm189d-ranbp1
PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d5ysua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ysua_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevv
ddpalaaqyehdlevaqttalpdedddl

SCOPe Domain Coordinates for d5ysua_:

Click to download the PDB-style file with coordinates for d5ysua_.
(The format of our PDB-style files is described here.)

Timeline for d5ysua_:

  • d5ysua_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22