Lineage for d5xlna_ (5xln A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962762Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2962763Protein automated matches [190708] (10 species)
    not a true protein
  7. 2962799Species Human (Homo sapiens) [TaxId:9606] [187914] (8 PDB entries)
  8. 2962804Domain d5xlna_: 5xln A: [360498]
    automated match to d2jgba_
    protein/RNA complex

Details for d5xlna_

PDB Entry: 5xln (more details), 1.9 Å

PDB Description: crystal structure of the trs_une-t and 4ehp complex
PDB Compounds: (A:) eukaryotic translation initiation factor 4e type 2

SCOPe Domain Sequences for d5xlna_:

Sequence, based on SEQRES records: (download)

>d5xlna_ d.86.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kavvpgpaehplqynytfwysrrtpgrptssqsyeqnikqigtfasveqfwrfyshmvrp
gdltghsdfhlfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvge
eicgavvsvrfqediisiwnktasdqattarirdtlrrvlnlppntimeykthtd

Sequence, based on observed residues (ATOM records): (download)

>d5xlna_ d.86.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kavvpgpaehplqynytfwysrrteqnikqigtfasveqfwrfyshmvrpgdltghsdfh
lfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavvsvr
fqediisiwnktasdqattarirdtlrrvlnlppntimeykthtd

SCOPe Domain Coordinates for d5xlna_:

Click to download the PDB-style file with coordinates for d5xlna_.
(The format of our PDB-style files is described here.)

Timeline for d5xlna_: