SCOPe 2.07: Domain d6msyh2: 6msy H:116-227

Lineage for d6msyh2 (6msy H:116-227)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (184 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d6msyh2: 6msy H:116-227 [360497]
   Other proteins in same PDB: d6msyh1, d6msyl1, d6msyl2
   automated match to d1op3h2
   complexed with act, man, unx

Details for d6msyh2

PDB Entry: 6msy, 2 Å

PDB Description: anti-hiv-1 fab fab 2g12 + man4 re-refinement

PDB Compounds: (H:) FAB 2G12, heavy chain

SCOPe Domain Sequences for d6msyh2:

Sequence, based on SEQRES records:

>d6msyh2 b.1.1.2 (H:116-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d6msyh2 b.1.1.2 (H:116-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tkgpsvfplapggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssqtyicnvnhkpsntkvdkkvep

Timeline for d6msyh2:

• d6msyh2 is new in SCOPe 2.07-stable
  
• d6msyh2 appears in the current release, SCOPe 2.08