Lineage for d5wooa_ (5woo A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2492802Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 2492803Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 2492850Family c.119.1.0: automated matches [191443] (1 protein)
    not a true family
  6. 2492851Protein automated matches [190655] (12 species)
    not a true protein
  7. 3047646Species Staphylococcus aureus [TaxId:1280] [347708] (4 PDB entries)
  8. 3060431Domain d5wooa_: 5woo A: [360493]
    Other proteins in same PDB: d5woob2
    automated match to d3pl5a_
    complexed with gol, myr

Details for d5wooa_

PDB Entry: 5woo (more details), 1.78 Å

PDB Description: the crystal structure of the staphylococcus aureus fatty acid kinase (fak) b1 protein loaded with myristic acid (c14:0) to 1.78 angstrom resolution
PDB Compounds: (A:) EDD domain protein, DegV family

SCOPe Domain Sequences for d5wooa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wooa_ c.119.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkiavmtdstsylsqdlidkyniqiaplsvtfddgknftesneiaieefynkmassqtip
ttsqpaigewitkyemlrdqgytdiiviclssgisgsyqssyqagemvegvnvhafdskl
aamiegcyvlraiemveegyepqqiiddltnmrehtgaylivddlknlqksgritgaqaw
vgtllkmkpvlkfedgkiipeekvrtkkraiqtlekkvldivkdfeevtlfvingdhfed
gqalykklqddcpsayqvaysefgpvvaahlgsgglglgyvgrkirlt

SCOPe Domain Coordinates for d5wooa_:

Click to download the PDB-style file with coordinates for d5wooa_.
(The format of our PDB-style files is described here.)

Timeline for d5wooa_:

  • d5wooa_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22