SCOPe 2.08: Domain d5uxya_: 5uxy A:

Lineage for d5uxya_ (5uxy A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
   2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]

4. Superfamily c.119.1: DAK1/DegV-like [82549] (3 families)
   domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different

5. Family c.119.1.0: automated matches [191443] (1 protein)
   not a true family

6. Protein automated matches [190655] (13 species)
   not a true protein

7. Species Eubacterium eligens [TaxId:39485] [188765] (2 PDB entries)

8. Domain d5uxya_: 5uxy A: [360490]
   automated match to d3fdja_
   complexed with acy, na, x90

Details for d5uxya_

PDB Entry: 5uxy, 1.8 Å

PDB Description: the crystal structure of a degv family protein from eubacterium eligens loaded with heptadecanoic acid to 1.80 angstrom resolution (alternative refinement of pdb 3fdj with heptadecanoic acid)

PDB Compounds: (A:) DegV family protein

SCOPe Domain Sequences for d5uxya_:

Sequence; same for both SEQRES and ATOM records:

>d5uxya_ c.119.1.0 (A:) automated matches {Eubacterium eligens [TaxId: 39485]}
amrlvadsacdikelrgmvfkavpltistdneefcddgqldihrmldilekhkgrsytac
pgidawleafgdddeifvvtitagmsgtynsamaaravyleehpqakvrvidskstgpqm
riileqlqqmieegkkfeeidgaidaymqktrlfcslkslhnlaqngrvskvvasaaevl
gisvigtasshgtleaigkcrgdkkllvklqallddagyeggklrichvenealadkiad
mikqaygttdvcvykagglcsyyaerggiilscetk

Timeline for d5uxya_:

• d5uxya_ first appeared in SCOPe 2.07