Lineage for d5qj1a_ (5qj1 A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2572036Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 2572350Protein automated matches [190260] (25 species)
    not a true protein
  7. 3060424Species Hepacivirus c [TaxId:11103] [360486] (2 PDB entries)
  8. 3060425Domain d5qj1a_: 5qj1 A: [360487]
    automated match to d5pzoa_
    protein/RNA complex; complexed with gol, j6j, pg4, so4

Details for d5qj1a_

PDB Entry: 5qj1 (more details), 2.17 Å

PDB Description: crystal structure of the hepatitis c virus genotype 2a strain jfh1 l30s ns5b rna-dependent rna polymerase in complex with 6- (ethylamino)-2-(4-fluorophenyl)-5-(3-{[1-(5-fluoropyrimidin-2-yl) cyclopropyl]carbamoyl}-4-methoxyphenyl)-n-methyl-1-benzofuran-3- carboxamide
PDB Compounds: (A:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d5qj1a_:

Sequence, based on SEQRES records: (download)

>d5qj1a_ e.8.1.4 (A:) automated matches {Hepacivirus c [TaxId: 11103]}
smsyswtgalitpcspeeeklpinplsnsslryhnkvycttsksasqrakkvtfdrtqvl
dahydsvlkdiklaaskvsarlltleeacqltpphsarskygfgakevrslsgravnhik
svwkdlledpqtpipttimaknevfcvdpakggkkparlivypdlgvrvcekmalyditq
klpqavmgasygfqyspaqrveyllkawaekkdpmgfsydtrcfdstvterdirteesiy
qacslpeeartaihslterlyvggpmfnskgqtcgyrrcrasgvlttsmgntitcyvkal
aackaagivaptmlvcgddlvvisesqgteedernlrafteamtrysappgdpprpeydl
elitscssnvsvalgprgrrryyltrdpttplaraawetvrhspinswlgniiqyaptiw
vrmvlmthffsilmvqdtldqnlnfemygsvysvnpldlpaiierlhgldafsmhtyshh
eltrvasalrklgapplrvwksraravraslisrggkaavcgrylfnwavktklkltplp
earlldl

Sequence, based on observed residues (ATOM records): (download)

>d5qj1a_ e.8.1.4 (A:) automated matches {Hepacivirus c [TaxId: 11103]}
smsyswtgalitpcspeeeklpinplsnsslryhnkvycttsksasqrakkvtfdrtqvl
dahydsvlkdiklaaskvsarlltleeacqltpphsarskygfgakevrslsgravnhik
svwkdlledpqtpipttimaknevfcvdgkkparlivypdlgvrvcekmalyditqklpq
avmgasygfqyspaqrveyllkawaekkdpmgfsydtrcfdstvterdirteesiyqacs
lpeeartaihslterlyvggpmfnskgqtcgyrrcrasgvlttsmgntitcyvkalaack
aagivaptmlvcgddlvvisesqgteedernlrafteamtrysappgdpprpeydlelit
scssnvsvalgprgrrryyltrdpttplaraawetvrhspinswlgniiqyaptiwvrmv
lmthffsilmvqdtldqnlnfemygsvysvnpldlpaiierlhgldafsmhtyshheltr
vasalrklgapplrvwksraravraslisrggkaavcgrylfnwavktklkltplpearl
ldl

SCOPe Domain Coordinates for d5qj1a_:

Click to download the PDB-style file with coordinates for d5qj1a_.
(The format of our PDB-style files is described here.)

Timeline for d5qj1a_:

  • d5qj1a_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22