Lineage for d6mweb_ (6mwe B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (18 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (704 PDB entries)
  8. 3060422Domain d6mweb_: 6mwe B: [360484]
    automated match to d1fvra_
    complexed with 919, so4

Details for d6mweb_

PDB Entry: 6mwe (more details), 2.05 Å

PDB Description: crystal structure of tie2 in complex with decipera compound dp1919
PDB Compounds: (B:) Angiopoietin-1 receptor

SCOPe Domain Sequences for d6mweb_:

Sequence, based on SEQRES records: (download)

>d6mweb_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ypvldwndikfqdvigegnfgqvlkarikkdglrmdaaikrmkeyaskddhrdfagelev
lcklghhpniinllgacehrgylylaieyaphgnlldflrksrvletdpafaianstast
lssqqllhfaadvargmdylsqkqfihrdlaarnilvgenyvakiadfglsrgqevyvkk
tmgrlpvrwmaieslnysvyttnsdvwsygvllweivslggtpycgmtcaelyeklpqgy
rlekplncddevydlmrqcwrekpyerpsfaqilvslnrmleerktyvnttlyekftyag
idcsaee

Sequence, based on observed residues (ATOM records): (download)

>d6mweb_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ypvldwndikfqdvigegnfgqvlkarikkdglrmdaaikrgelevlcklghhpniinll
gacehrgylylaieyaphgnlldflrksrvletdpafaianstastlssqqllhfaadva
rgmdylsqkqfihrdlaarnilvgenyvakiadfglsrgqevktmgrlpvrwmaieslny
svyttnsdvwsygvllweivslggtpycgmtcaelyeklpqgyrlekplncddevydlmr
qcwrekpyerpsfaqilvslnrmleerktyvnttlyekftyagidcsaee

SCOPe Domain Coordinates for d6mweb_:

Click to download the PDB-style file with coordinates for d6mweb_.
(The format of our PDB-style files is described here.)

Timeline for d6mweb_:

  • d6mweb_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22