Lineage for d6mwqg_ (6mwq G:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508387Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2508388Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2508389Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2508393Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 2508399Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (207 PDB entries)
    Uniprot P42212
  8. 3060421Domain d6mwqg_: 6mwq G: [360483]
    automated match to d3ogoc_

Details for d6mwqg_

PDB Entry: 6mwq (more details), 3 Å

PDB Description: single particle cryoem structure of a darpin-aldolase platform in complex with gfp
PDB Compounds: (G:) Green fluorescent protein

SCOPe Domain Sequences for d6mwqg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mwqg_ d.22.1.1 (G:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttlvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnrie
lkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyqq
ntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

SCOPe Domain Coordinates for d6mwqg_:

Click to download the PDB-style file with coordinates for d6mwqg_.
(The format of our PDB-style files is described here.)

Timeline for d6mwqg_:

  • d6mwqg_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22