Lineage for d6igdi_ (6igd I:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409884Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2411049Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2411050Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 2411120Protein automated matches [191200] (9 species)
    not a true protein
  7. 2411121Species Human papillomavirus type 58 [TaxId:10598] [340764] (2 PDB entries)
  8. 3060419Domain d6igdi_: 6igd I: [360481]
    automated match to d5y9ea_

Details for d6igdi_

PDB Entry: 6igd (more details), 2.5 Å

PDB Description: crystal structure of hpv58/33 chimeric l1 pentamer
PDB Compounds: (I:) Major capsid protein L1

SCOPe Domain Sequences for d6igdi_:

Sequence, based on SEQRES records: (download)

>d6igdi_ b.121.6.1 (I:) automated matches {Human papillomavirus type 58 [TaxId: 10598]}
kvvstdeyvsrtsiyyyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlp
dpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaq
pgsdnreclsmdykqtqlcligckpptgehwgkgvasnnnaaatdcpplelfnsiiedgd
mvdtgfgcmdfgtlqanksdvpidicnstckypdylkmasepygdslffflrreqmfvrh
ffnragklgeavpddlyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqgh
nngicwgnqlfvtvvdttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlck
itltaeimtyihtmdsniledwqfgltpppsaslqdtyrfvtsqaitcqktappkekedp
lnkytfwevnlkekfsadldqfplgrkfllqsgl

Sequence, based on observed residues (ATOM records): (download)

>d6igdi_ b.121.6.1 (I:) automated matches {Human papillomavirus type 58 [TaxId: 10598]}
kvvstdeyvsrtsiyyyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlp
dpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaq
pgsdnreclsmdykqtqlcligckpptgehwgkgvasatdcpplelfnsiiedgdmvdtg
fgcmdfgtlqanksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnra
gklgeavpddlyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngic
wgnqlfvtvvdttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitlta
eimtyihtmdsniledwqfedplnkytfwevnlkekfsadldqfplgrkfllqsgl

SCOPe Domain Coordinates for d6igdi_:

Click to download the PDB-style file with coordinates for d6igdi_.
(The format of our PDB-style files is described here.)

Timeline for d6igdi_:

  • d6igdi_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22