Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) |
Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins) |
Protein RNase Sa [53935] (1 species) |
Species Streptomyces aureofaciens [TaxId:1894] [53936] (16 PDB entries) |
Domain d1rsnb_: 1rsn B: [36047] complexed with sgp, so4 |
PDB Entry: 1rsn (more details), 2 Å
SCOP Domain Sequences for d1rsnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rsnb_ d.1.1.2 (B:) RNase Sa {Streptomyces aureofaciens} dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp gartrgtrriicgeatqedyytgdhyatfslidqtc
Timeline for d1rsnb_: