SCOP 1.63: Domain d1rsnb_: 1rsn B:

Lineage for d1rsnb_ (1rsn B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)

6. Protein RNase Sa [53935] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [53936] (16 PDB entries)

8. Domain d1rsnb_: 1rsn B: [36047]
   complexed with sgp, so4

Details for d1rsnb_

PDB Entry: 1rsn, 2 Å

PDB Description: ribonuclease (rnase sa) (e.c.3.1.4.8) complexed with exo-2',3'-cyclophosphorothioate

SCOP Domain Sequences for d1rsnb_:

Sequence; same for both SEQRES and ATOM records:

>d1rsnb_ d.1.1.2 (B:) RNase Sa {Streptomyces aureofaciens}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriicgeatqedyytgdhyatfslidqtc

Timeline for d1rsnb_:

• d1rsnb_ first appeared (with stable ids) in SCOP 1.55
  
• d1rsnb_ appears in SCOP 1.61
  
• d1rsnb_ appears in SCOP 1.65
  
• d1rsnb_ appears in the current release, SCOPe 2.08