SCOPe 2.07: Domain d6msyl1: 6msy L:1-106

Lineage for d6msyl1 (6msy L:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6msyl1: 6msy L:1-106 [360469]
   Other proteins in same PDB: d6msyh1, d6msyh2, d6msyl2
   automated match to d3cfja1
   complexed with act, man, unx

Details for d6msyl1

PDB Entry: 6msy, 2 Å

PDB Description: anti-hiv-1 fab fab 2g12 + man4 re-refinement

PDB Compounds: (L:) FAB 2G12, light chain

SCOPe Domain Sequences for d6msyl1:

Sequence; same for both SEQRES and ATOM records:

>d6msyl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrvei

Timeline for d6msyl1:

• d6msyl1 is new in SCOPe 2.07-stable
  
• d6msyl1 appears in the current release, SCOPe 2.08