Lineage for d6n0uc_ (6n0u C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898466Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. 2898597Protein automated matches [191218] (6 species)
    not a true protein
  7. 2898624Species Paraburkholderia phymatum [TaxId:391038] [360463] (1 PDB entry)
  8. 2898627Domain d6n0uc_: 6n0u C: [360465]
    Other proteins in same PDB: d6n0ua2
    automated match to d5ifya_
    complexed with edo, trh

Details for d6n0uc_

PDB Entry: 6n0u (more details), 2.1 Å

PDB Description: crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
PDB Compounds: (C:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d6n0uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n0uc_ c.68.1.6 (C:) automated matches {Paraburkholderia phymatum [TaxId: 391038]}
markgiilaggsgtrlypithvvskqllpvydkpmiyyplstlmvagirdvliistpqdt
prfeamlgdgsqwgmniqyavqpspdglaqafiigrefvgndpsalilgdnifyghdlak
qleranartdgatvfayhvhdperygvvefdkdfralsieekpakprsnyavtglyfydn
qvcdiaadikpsargeleitdvnsrylsqktldveimgrgyawldtgthdslieaatfia
tlqkrqglvvacpeeiayrrkwinaeqllalarplsknaygqylqnlltdqvawp

SCOPe Domain Coordinates for d6n0uc_:

Click to download the PDB-style file with coordinates for d6n0uc_.
(The format of our PDB-style files is described here.)

Timeline for d6n0uc_: