Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins) automatically mapped to Pfam PF00483 |
Protein automated matches [191218] (6 species) not a true protein |
Species Paraburkholderia phymatum [TaxId:391038] [360463] (1 PDB entry) |
Domain d6n0uc_: 6n0u C: [360465] Other proteins in same PDB: d6n0ua2 automated match to d5ifya_ complexed with edo, trh |
PDB Entry: 6n0u (more details), 2.1 Å
SCOPe Domain Sequences for d6n0uc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n0uc_ c.68.1.6 (C:) automated matches {Paraburkholderia phymatum [TaxId: 391038]} markgiilaggsgtrlypithvvskqllpvydkpmiyyplstlmvagirdvliistpqdt prfeamlgdgsqwgmniqyavqpspdglaqafiigrefvgndpsalilgdnifyghdlak qleranartdgatvfayhvhdperygvvefdkdfralsieekpakprsnyavtglyfydn qvcdiaadikpsargeleitdvnsrylsqktldveimgrgyawldtgthdslieaatfia tlqkrqglvvacpeeiayrrkwinaeqllalarplsknaygqylqnlltdqvawp
Timeline for d6n0uc_:
View in 3D Domains from other chains: (mouse over for more information) d6n0ua1, d6n0ua2, d6n0ub_, d6n0ud_ |