Lineage for d6mgoa2 (6mgo A:147-371)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2460926Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2460927Protein Actin [53073] (9 species)
  7. 2460953Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (66 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 3060400Domain d6mgoa2: 6mgo A:147-371 [360462]
    automated match to d1sqka2
    complexed with adp, ca, jqv

Details for d6mgoa2

PDB Entry: 6mgo (more details), 2.2 Å

PDB Description: structure of rabbit actin in complex with mycalolide b
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d6mgoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mgoa2 c.55.1.1 (A:147-371) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivh

SCOPe Domain Coordinates for d6mgoa2:

Click to download the PDB-style file with coordinates for d6mgoa2.
(The format of our PDB-style files is described here.)

Timeline for d6mgoa2:

  • d6mgoa2 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22

View in 3D
Domains from same chain:
(mouse over for more information)
d6mgoa1