Lineage for d6mhrb2 (6mhr B:110-215)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1180 PDB entries)
  8. 3060395Domain d6mhrb2: 6mhr B:110-215 [360457]
    automated match to d5mvzb2
    complexed with bma, epe, fuc, gol, mli, nag

Details for d6mhrb2

PDB Entry: 6mhr (more details), 2.8 Å

PDB Description: structure of the human 4-1bb / urelumab fab complex
PDB Compounds: (B:) Urelumab Fab kappa chain

SCOPe Domain Sequences for d6mhrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mhrb2 b.1.1.0 (B:110-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6mhrb2:

Click to download the PDB-style file with coordinates for d6mhrb2.
(The format of our PDB-style files is described here.)

Timeline for d6mhrb2:

  • d6mhrb2 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22

View in 3D
Domains from same chain:
(mouse over for more information)
d6mhrb1