Lineage for d6f7hc_ (6f7h C:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577537Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 2577538Superfamily f.19.1: Aquaporin-like [81338] (2 families) (S)
  5. 2577589Family f.19.1.0: automated matches [191436] (1 protein)
    not a true family
  6. 2577590Protein automated matches [190629] (7 species)
    not a true protein
  7. 2577600Species Human (Homo sapiens) [TaxId:9606] [225512] (6 PDB entries)
  8. 3060390Domain d6f7hc_: 6f7h C: [360452]
    automated match to d1ldfa_
    complexed with bng, gol

Details for d6f7hc_

PDB Entry: 6f7h (more details), 2.3 Å

PDB Description: crystal structure of human aqp10
PDB Compounds: (C:) Aquaporin-10

SCOPe Domain Sequences for d6f7hc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f7hc_ f.19.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
irsllarqclaeflgvfvlmlltqgavaqavtsgetkgnfftmflagslavtiaiyvggn
vsgahlnpafslamcivgrlpwvklpiyilvqllsafcasgatyvlyhdalqnytggnlt
vtgpketasifatypapylslnngfldqvlgtgmlivgllaildrrnkgvpaglepvvvg
mlilalglsmgancgiplnpardlgprlftyvagwgpevfsagngwwwvpvvaplvgatv
gtatyqllvalhh

SCOPe Domain Coordinates for d6f7hc_:

Click to download the PDB-style file with coordinates for d6f7hc_.
(The format of our PDB-style files is described here.)

Timeline for d6f7hc_:

  • d6f7hc_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22