Lineage for d6m7xb_ (6m7x B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (78 species)
    not a true protein
  7. 2331745Species Human (Homo sapiens) [TaxId:9606] [196470] (42 PDB entries)
  8. 3060381Domain d6m7xb_: 6m7x B: [360443]
    automated match to d4dvqb_
    complexed with hem, jd7

Details for d6m7xb_

PDB Entry: 6m7x (more details), 2.1 Å

PDB Description: structure of human cyp11b1 in complex with fadrozole
PDB Compounds: (B:) Cytochrome P450 11B1, mitochondrial

SCOPe Domain Sequences for d6m7xb_:

Sequence, based on SEQRES records: (download)

>d6m7xb_ a.104.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvlpfeamprrpgnrwlrllqiwreqgyedlhlevhqtfqelgpifrydlggagmvcvml
pedveklqqvdslhphrmslepwvayrqhrghkcgvfllngpewrfnrlrlnpevlspna
vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
hspssaslnflhalevmfkstvqlmfmprslsrwtspkvwkehfeawdcifqygdnciqk
iyqelafsrpqqytsivaelllnaelspdaikansmeltagsvdttvfpllmtlfelarn
pnvqqalrqeslaaaasisehpqkattelpllraalketlrlypvglflervassdlvlq
nyhipagtlvrvflyslgrnpalfprperynpqrwldirgsgrnfyhvpfgfgmrqclgr
rlaeaemllllhhvlkhlqvetltqedikmvysfilrpsmfplltfrai

Sequence, based on observed residues (ATOM records): (download)

>d6m7xb_ a.104.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvlpfeamprrpgnrwlrllqiwreqgyedlhlevhqtfqelgpifrydlggagmvcvml
pedveklqqvdslhphrmslepwvayrqhrghkcgvfllngpewrfnrlrlnpevlspna
vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
hspssaslnflhalevmfkstvqlmfmprslsrwtspkvwkehfeawdcifqygdnciqk
iyqelafytsivaelllnaelspdaikansmeltagsvdttvfpllmtlfelarnpnvqq
alrqeslaaaasisehpqkattelpllraalketlrlypvglflervassdlvlqnyhip
agtlvrvflyslgrnpalfprperynpqrwldirrnfyhvpfgfgmrqclgrrlaeaeml
lllhhvlkhlqvetltqedikmvysfilrpsmfplltfrai

SCOPe Domain Coordinates for d6m7xb_:

Click to download the PDB-style file with coordinates for d6m7xb_.
(The format of our PDB-style files is described here.)

Timeline for d6m7xb_:

  • d6m7xb_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22