Lineage for d6broc1 (6bro C:81-160)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735465Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2735466Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2735513Family a.157.1.0: automated matches [227205] (1 protein)
    not a true family
  6. 2735514Protein automated matches [226937] (1 species)
    not a true protein
  7. 2735515Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225249] (9 PDB entries)
  8. 2735524Domain d6broc1: 6bro C:81-160 [360433]
    automated match to d3wsob2

Details for d6broc1

PDB Entry: 6bro (more details), 2.5 Å

PDB Description: crystal structure of ask1-d3 ubiquitin ligase form1
PDB Compounds: (C:) SKP1-like protein 1A

SCOPe Domain Sequences for d6broc1:

Sequence, based on SEQRES records: (download)

>d6broc1 a.157.1.0 (C:81-160) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ddlkawdadfmkidqatlfelilaanylniknlldltcqtvadmikgktpeeirttfnik
ndftpeeeeevrrenqwafe

Sequence, based on observed residues (ATOM records): (download)

>d6broc1 a.157.1.0 (C:81-160) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ddldadfmkidqatlfelilaanylniknlldltcqtvadmikgktpeeirttfnikndf
tpeeeeevrrenqwafe

SCOPe Domain Coordinates for d6broc1:

Click to download the PDB-style file with coordinates for d6broc1.
(The format of our PDB-style files is described here.)

Timeline for d6broc1: