Lineage for d6ex3b2 (6ex3 B:92-198)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513720Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2513721Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2514007Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2514008Protein automated matches [226860] (35 species)
    not a true protein
  7. 3046625Species Staphylococcus aureus [TaxId:1280] [346687] (4 PDB entries)
  8. 3060369Domain d6ex3b2: 6ex3 B:92-198 [360431]
    Other proteins in same PDB: d6ex3a1, d6ex3b1, d6ex3c1, d6ex3d1
    automated match to d2rcva2
    complexed with fe

Details for d6ex3b2

PDB Entry: 6ex3 (more details), 2.2 Å

PDB Description: staphylococcus aureus superoxide dismutase soda
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d6ex3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ex3b2 d.44.1.0 (B:92-198) automated matches {Staphylococcus aureus [TaxId: 1280]}
seekgtvvekikeqwgsleefkkefadkaaarfgsgwawlvvnngqleivttpnqdnplt
egktpilgldvwehayylkyqnkrpdyigafwnvvnwekvdelynat

SCOPe Domain Coordinates for d6ex3b2:

Click to download the PDB-style file with coordinates for d6ex3b2.
(The format of our PDB-style files is described here.)

Timeline for d6ex3b2:

  • d6ex3b2 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22