Lineage for d6idna_ (6idn A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (103 species)
    not a true protein
  7. 3060359Species Ipomoea carnea [TaxId:89640] [360421] (1 PDB entry)
  8. 3060360Domain d6idna_: 6idn A: [360422]
    automated match to d2gsja_
    complexed with bma, ca, fuc, man, nag, xyp

Details for d6idna_

PDB Entry: 6idn (more details), 1.5 Å

PDB Description: crystal structure of icchi chitinase from ipomoea carnea
PDB Compounds: (A:) ICChI, a glycosylated chitinase

SCOPe Domain Sequences for d6idna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6idna_ c.1.8.0 (A:) automated matches {Ipomoea carnea [TaxId: 89640]}
geiaiywgqdggegslretcdtddydiinigflttfghsttpilnltkhcnpatsackfl
sseisyckskgikvflslgggtgnyylssrddaasvaqylwnnflggqsesrplgdesld
gidfdiedgsndyydtlaeqlwilggrsgsnvylaaapacefpdyylreaintslfdyvw
vqfynnprchylgnatnllnswnndwstiltddlflglpaapqaapgggfieaddlisev
lptikatydyggvmlwskyydddysskikpdv

SCOPe Domain Coordinates for d6idna_:

Click to download the PDB-style file with coordinates for d6idna_.
(The format of our PDB-style files is described here.)

Timeline for d6idna_:

  • d6idna_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22