Lineage for d6ex3a1 (6ex3 A:2-91)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2302754Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303043Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303322Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2303323Protein automated matches [226859] (36 species)
    not a true protein
  7. 3046623Species Staphylococcus aureus [TaxId:1280] [346685] (4 PDB entries)
  8. 3060344Domain d6ex3a1: 6ex3 A:2-91 [360406]
    Other proteins in same PDB: d6ex3a2, d6ex3b2, d6ex3c2, d6ex3d2
    automated match to d2rcva1
    complexed with fe

Details for d6ex3a1

PDB Entry: 6ex3 (more details), 2.2 Å

PDB Description: staphylococcus aureus superoxide dismutase soda
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d6ex3a1:

Sequence, based on SEQRES records: (download)

>d6ex3a1 a.2.11.0 (A:2-91) automated matches {Staphylococcus aureus [TaxId: 1280]}
afelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanld
svpaniqtavrnnggghlnhslfwellspn

Sequence, based on observed residues (ATOM records): (download)

>d6ex3a1 a.2.11.0 (A:2-91) automated matches {Staphylococcus aureus [TaxId: 1280]}
afelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanlv
paniqtavrnnggghlnhslfwellspn

SCOPe Domain Coordinates for d6ex3a1:

Click to download the PDB-style file with coordinates for d6ex3a1.
(The format of our PDB-style files is described here.)

Timeline for d6ex3a1:

  • d6ex3a1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22