Lineage for d6faza1 (6faz A:3-263)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2485908Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2486152Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2486164Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (138 PDB entries)
  8. 3060342Domain d6faza1: 6faz A:3-263 [360404]
    Other proteins in same PDB: d6faza2
    automated match to d4h8ja_
    complexed with act, cl, d45, edo, glu, gol, peg, so4

Details for d6faza1

PDB Entry: 6faz (more details), 1.4 Å

PDB Description: crystal structure of the glua2 ligand-binding domain (s1s2j) in complex with the positive allosteric modulator tdpam01 at 1.4 a resolution.
PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d6faza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6faza1 c.94.1.1 (A:3-263) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgecgs

SCOPe Domain Coordinates for d6faza1:

Click to download the PDB-style file with coordinates for d6faza1.
(The format of our PDB-style files is described here.)

Timeline for d6faza1:

  • d6faza1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22

View in 3D
Domains from same chain:
(mouse over for more information)
d6faza2
View in 3D
Domains from other chains:
(mouse over for more information)
d6fazb_