Lineage for d6eywx_ (6eyw X:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334581Superfamily a.118.27: DIL domain-like [310601] (1 family) (S)
    Pfam PF01843
  5. 2334582Family a.118.27.1: DIL domains from class V myosins [310651] (6 proteins)
  6. 2334613Protein automated matches [310888] (2 species)
    not a true protein
  7. 2334614Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [311398] (6 PDB entries)
  8. 3060336Domain d6eywx_: 6eyw X: [360398]
    automated match to d2f6hx_

Details for d6eywx_

PDB Entry: 6eyw (more details), 2.88 Å

PDB Description: structure of yeast myosin 5 cargo binding domain in trigonal space group
PDB Compounds: (X:) Myosin-2

SCOPe Domain Sequences for d6eywx_:

Sequence, based on SEQRES records: (download)

>d6eywx_ a.118.27.1 (X:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
atqineelyrlledteilnqeitegllkgfevpdagvaiqlskrdvvypariliivlsem
wrfgltkqsesflaqvlttiqkvvtqlkgndlipsgvfwlanvrelysfvvfalnsilte
etfkngmtdeeykeyvslvtelkddfealsyniyniwlkklqkqlqkkainavviseslp
gfsagetsgflnkifanteeytmddiltffnsiywcmksfhienevfhavvttllnyvda
icfnelimkrnflswkrglqlnynvtrleewckthgltdgteclqhliqtakllqvrkyt
iedidilrgicysltpaqlqklisqyqvadyespipqeilryvadivkkeaalsssgnds
kghehsssifitpetgpftdpfsliktrkfdqveayipawlslpstkrivdlvaqqvv

Sequence, based on observed residues (ATOM records): (download)

>d6eywx_ a.118.27.1 (X:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
atqineelyrlledteilnqeitegllkgfevpdagvaiqlskrdvvypariliivlsem
wrfgltkqsesflaqvlttiqkvvtqlkgndlipsgvfwlanvrelysfvvfalnsilte
etmtdeeykeyvslvtelkddfealsyniyniwlkklqkqlqkkainavvisesleytmd
diltffnsiywcmksfhienevfhavvttllnyvdaicfnelimkrnflswkrglqlnyn
vtrleewckthgltdgteclqhliqtakllqvrkytiedidilrgicysltpaqlqklis
qyqvadyespipqeilryvadivkkeaalssifitpetgpftdpfsliktrkfdqveayi
pawlslpstkrivdlvaqqvv

SCOPe Domain Coordinates for d6eywx_:

Click to download the PDB-style file with coordinates for d6eywx_.
(The format of our PDB-style files is described here.)

Timeline for d6eywx_:

  • d6eywx_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22