Lineage for d6brpc1 (6brp C:4-65)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513558Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2513559Protein automated matches [190710] (4 species)
    not a true protein
  7. 2513673Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225248] (4 PDB entries)
  8. 3060332Domain d6brpc1: 6brp C:4-65 [360394]
    Other proteins in same PDB: d6brpa2, d6brpc2
    automated match to d3wsob1

Details for d6brpc1

PDB Entry: 6brp (more details), 2.39 Å

PDB Description: f-box protein form 2
PDB Compounds: (C:) SKP1-like protein 1A

SCOPe Domain Sequences for d6brpc1:

Sequence, based on SEQRES records: (download)

>d6brpc1 d.42.1.0 (C:4-65) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kkivlkssdgesfeveeavalesqtiahmveddcvdngvplpnvtskilakvieyckrhv
ea

Sequence, based on observed residues (ATOM records): (download)

>d6brpc1 d.42.1.0 (C:4-65) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kkivlkssdgesfeveeavalesqtiahmvngvplpnvtskilakvieyckrhvea

SCOPe Domain Coordinates for d6brpc1:

Click to download the PDB-style file with coordinates for d6brpc1.
(The format of our PDB-style files is described here.)

Timeline for d6brpc1:

  • d6brpc1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22

View in 3D
Domains from same chain:
(mouse over for more information)
d6brpc2