Lineage for d6broa1 (6bro A:87-160)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341036Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2341037Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2341074Family a.157.1.0: automated matches [227205] (1 protein)
    not a true family
  6. 2341075Protein automated matches [226937] (1 species)
    not a true protein
  7. 2341076Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225249] (9 PDB entries)
  8. 3060325Domain d6broa1: 6bro A:87-160 [360387]
    automated match to d3wsob2

Details for d6broa1

PDB Entry: 6bro (more details), 2.5 Å

PDB Description: crystal structure of ask1-d3 ubiquitin ligase form1
PDB Compounds: (A:) SKP1-like protein 1A

SCOPe Domain Sequences for d6broa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6broa1 a.157.1.0 (A:87-160) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dadfmkidqatlfelilaanylniknlldltcqtvadmikgktpeeirttfnikndftpe
eeeevrrenqwafe

SCOPe Domain Coordinates for d6broa1:

Click to download the PDB-style file with coordinates for d6broa1.
(The format of our PDB-style files is described here.)

Timeline for d6broa1:

  • d6broa1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22