Lineage for d6bn3a_ (6bn3 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3015028Species Salmonella enterica [TaxId:28901] [360383] (2 PDB entries)
  8. 3015029Domain d6bn3a_: 6bn3 A: [360384]
    automated match to d1g6aa_
    complexed with epe

Details for d6bn3a_

PDB Entry: 6bn3 (more details), 1.28 Å

PDB Description: ctx-m-151 class a extended-spectrum beta-lactamase apo crystal structure at 1.3 angstrom resolution
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6bn3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bn3a_ e.3.1.0 (A:) automated matches {Salmonella enterica [TaxId: 28901]}
anhiqhqmvqqlsaleksangrlgvavidtgsgaiagwrmdepfpmcstskvmavaallk
qseqtpelmsqpqpvasgdlvnynpiterfvgksmtfdelsaatlqysdnaamnlilakl
ggpqkvtafarsigddkfrldrnepslntaipgdlrdtstpramalslqklalgdalgqv
qreklshwlrgnttgaasiraglpsgwsvgdktgsgdygttndiavvwptgrpplvivty
ftqpqqqaesqrpvlakaaaivashyv

SCOPe Domain Coordinates for d6bn3a_:

Click to download the PDB-style file with coordinates for d6bn3a_.
(The format of our PDB-style files is described here.)

Timeline for d6bn3a_: