Lineage for d6bn3a_ (6bn3 A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2569658Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2569659Protein automated matches [190857] (49 species)
    not a true protein
  7. 3060321Species Salmonella enterica [TaxId:28901] [360383] (2 PDB entries)
  8. 3060322Domain d6bn3a_: 6bn3 A: [360384]
    automated match to d1g6aa_
    complexed with epe

Details for d6bn3a_

PDB Entry: 6bn3 (more details), 1.28 Å

PDB Description: ctx-m-151 class a extended-spectrum beta-lactamase apo crystal structure at 1.3 angstrom resolution.
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6bn3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bn3a_ e.3.1.0 (A:) automated matches {Salmonella enterica [TaxId: 28901]}
anhiqhqmvqqlsaleksangrlgvavidtgsgaiagwrmdepfpmcstskvmavaallk
qseqtpelmsqpqpvasgdlvnynpiterfvgksmtfdelsaatlqysdnaamnlilakl
ggpqkvtafarsigddkfrldrnepslntaipgdlrdtstpramalslqklalgdalgqv
qreklshwlrgnttgaasiraglpsgwsvgdktgsgdygttndiavvwptgrpplvivty
ftqpqqqaesqrpvlakaaaivashyv

SCOPe Domain Coordinates for d6bn3a_:

Click to download the PDB-style file with coordinates for d6bn3a_.
(The format of our PDB-style files is described here.)

Timeline for d6bn3a_:

  • d6bn3a_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22