Lineage for d6eylb_ (6eyl B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2487255Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2487256Protein automated matches [190039] (149 species)
    not a true protein
  7. 2487360Species Bacillus subtilis [TaxId:535025] [189693] (7 PDB entries)
  8. 3060314Domain d6eylb_: 6eyl B: [360376]
    automated match to d3r6ua_
    complexed with 152

Details for d6eylb_

PDB Entry: 6eyl (more details), 1.5 Å

PDB Description: crystal structure of opubc in complex with carnitine
PDB Compounds: (B:) Osmotically activated L-carnitine/choline ABC transporter substrate-binding protein OpuCC

SCOPe Domain Sequences for d6eylb_:

Sequence, based on SEQRES records: (download)

>d6eylb_ c.94.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 535025]}
glsaaadqtikigaqsmseseiiasmlgqliehhtdlktttiknlgsnavqqqalmngei
diaatrytgtaltgtlrmepekdpdkalaltqrefkkrydlkwydsygfdntyaftvske
ladqyhletvsdvkkwapqlklgvdnywmklkgngyqdftktygmtfggtypmqiglvyd
avksgkmdivlaystdgriksyglkmlkddkqffppydcspvvpekvlkehpelegiikk
mlgkidtatmqelnyevdgnlkepsvvakeylekhryfes

Sequence, based on observed residues (ATOM records): (download)

>d6eylb_ c.94.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 535025]}
glsaaadqtikigaqsmseseiiasmlgqliehhtdlktttiknlgsnavqqqalmngei
diaatrytgtaltgtlrmepekdpdkalaltqrefkkrydlkwydsygfdntyaftvske
ladqyhletvsdvkkwapqlklgvdnywngyqdftktygmtfggtypmqiglvydavksg
kmdivlaystdgriksyglkmlkddkqffppydcspvvpekvlkehpelegiikkmlgki
dtatmqelnyevdgnlkepsvvakeylekhryfes

SCOPe Domain Coordinates for d6eylb_:

Click to download the PDB-style file with coordinates for d6eylb_.
(The format of our PDB-style files is described here.)

Timeline for d6eylb_:

  • d6eylb_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22