Lineage for d6eyla_ (6eyl A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2487255Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2487256Protein automated matches [190039] (148 species)
    not a true protein
  7. 2487360Species Bacillus subtilis [TaxId:535025] [189693] (7 PDB entries)
  8. 3060313Domain d6eyla_: 6eyl A: [360375]
    automated match to d3r6ua_
    complexed with 152

Details for d6eyla_

PDB Entry: 6eyl (more details), 1.5 Å

PDB Description: crystal structure of opubc in complex with carnitine
PDB Compounds: (A:) Osmotically activated L-carnitine/choline ABC transporter substrate-binding protein OpuCC

SCOPe Domain Sequences for d6eyla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eyla_ c.94.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 535025]}
glsaaadqtikigaqsmseseiiasmlgqliehhtdlktttiknlgsnavqqqalmngei
diaatrytgtaltgtlrmepekdpdkalaltqrefkkrydlkwydsygfdntyaftvske
ladqyhletvsdvkkwapqlklgvdnywmklkgngyqdftktygmtfggtypmqiglvyd
avksgkmdivlaystdgriksyglkmlkddkqffppydcspvvpekvlkehpelegiikk
mlgkidtatmqelnyevdgnlkepsvvakeylekhryfes

SCOPe Domain Coordinates for d6eyla_:

Click to download the PDB-style file with coordinates for d6eyla_.
(The format of our PDB-style files is described here.)

Timeline for d6eyla_:

  • d6eyla_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22