Lineage for d6ahgb_ (6ahg B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373041Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2373045Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 2373066Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (66 PDB entries)
    Uniprot P81461
  8. 3060308Domain d6ahgb_: 6ahg B: [360370]
    automated match to d1nlsa_
    complexed with ca, cd

Details for d6ahgb_

PDB Entry: 6ahg (more details), 2.83 Å

PDB Description: trimeric structure of concanavalin a from canavalia ensiformis
PDB Compounds: (B:) Concanavalin-A,Concanavalin-A

SCOPe Domain Sequences for d6ahgb_:

Sequence, based on SEQRES records: (download)

>d6ahgb_ b.29.1.1 (B:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d6ahgb_ b.29.1.1 (B:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnse
tnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiw
essavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d6ahgb_:

Click to download the PDB-style file with coordinates for d6ahgb_.
(The format of our PDB-style files is described here.)

Timeline for d6ahgb_:

  • d6ahgb_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22