SCOP 1.63: Domain d1gmpb_: 1gmp B:

Lineage for d1gmpb_ (1gmp B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)

6. Protein RNase Sa [53935] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [53936] (16 PDB entries)

8. Domain d1gmpb_: 1gmp B: [36037]
   complexed with 2gp, so4

Details for d1gmpb_

PDB Entry: 1gmp, 1.7 Å

PDB Description: complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution

SCOP Domain Sequences for d1gmpb_:

Sequence; same for both SEQRES and ATOM records:

>d1gmpb_ d.1.1.2 (B:) RNase Sa {Streptomyces aureofaciens}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriicgeatqedyytgdhyatfslidqtc

Timeline for d1gmpb_:

• d1gmpb_ first appeared (with stable ids) in SCOP 1.55
  
• d1gmpb_ appears in SCOP 1.61
  
• d1gmpb_ appears in SCOP 1.65
  
• d1gmpb_ appears in the current release, SCOPe 2.08