Lineage for d6aiba_ (6aib A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (143 species)
    not a true protein
  7. 2452855Species Staphylococcus aureus [TaxId:282458] [193407] (9 PDB entries)
  8. 3060306Domain d6aiba_: 6aib A: [360368]
    automated match to d2gxqa_

Details for d6aiba_

PDB Entry: 6aib (more details), 1.5 Å

PDB Description: crystal structures of the n-terminal reca-like domain 1 of staphylococcus aureus dead-box cold shock rna helicase csha
PDB Compounds: (A:) DEAD-box ATP-dependent RNA helicase CshA

SCOPe Domain Sequences for d6aiba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aiba_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
fkelgisdntvqslesmgfkeptpiqkdsipyalqgidilgqaqtgtgktgafgipliek
vvgkqgvqslilaptrelamqvaeqlrefsrgqgvqvvtvfggmpierqikalkkgpqiv
vgtpgrvidhlnrrtlktdgihtlildeademmnmgfiddmrfimdkipavqrqtmlfsa
tmpkaiqalvqqfmkspkiik

SCOPe Domain Coordinates for d6aiba_:

Click to download the PDB-style file with coordinates for d6aiba_.
(The format of our PDB-style files is described here.)

Timeline for d6aiba_:

  • d6aiba_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-22