Lineage for d6bnxa1 (6bnx A:10-152)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2510574Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2510575Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2511044Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2511045Protein automated matches [190239] (23 species)
    not a true protein
  7. 3060296Species Zea mays [TaxId:4577] [360358] (3 PDB entries)
  8. 3060301Domain d6bnxa1: 6bnx A:10-152 [360363]
    automated match to d4mtsa_
    complexed with co; mutant

Details for d6bnxa1

PDB Entry: 6bnx (more details), 1.8 Å

PDB Description: crystal structure of v278e-glyoxalase i mutant from zea mays in space group p6(3)
PDB Compounds: (A:) lactoylglutathione lyase

SCOPe Domain Sequences for d6bnxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bnxa1 d.32.1.0 (A:10-152) automated matches {Zea mays [TaxId: 4577]}
aaeavvdwhkhdskrmlhavyrvgdldrtikyytecfgmkllrkrdvpdekytnaflgfg
pentnfaveltynygvdkydigtgfghfaianddvyklaenikskggkitrepgpvkggs
tviafaqdpdgymfeliqradtp

SCOPe Domain Coordinates for d6bnxa1:

Click to download the PDB-style file with coordinates for d6bnxa1.
(The format of our PDB-style files is described here.)

Timeline for d6bnxa1:

  • d6bnxa1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22

View in 3D
Domains from same chain:
(mouse over for more information)
d6bnxa2