Lineage for d6bnma1 (6bnm A:219-365)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394983Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2394984Protein automated matches [190052] (7 species)
    not a true protein
  7. 2395025Species Human (Homo sapiens) [TaxId:9606] [186914] (61 PDB entries)
  8. 3060298Domain d6bnma1: 6bnm A:219-365 [360360]
    Other proteins in same PDB: d6bnma2
    automated match to d5d3vb_
    complexed with cl

Details for d6bnma1

PDB Entry: 6bnm (more details), 1.9 Å

PDB Description: crystal structure of the p-rex2 ph domain
PDB Compounds: (A:) Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein

SCOPe Domain Sequences for d6bnma1:

Sequence, based on SEQRES records: (download)

>d6bnma1 b.55.1.0 (A:219-365) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eklevleewqshiegwegsnitdtctemlmcgvllkissgniqervfflfdnllvyckrk
hrrlknskastdghrylfrgrintevmevenvddgtadfhssghivvngwkihntaknkw
fvcmaktpeekhewfeailkererrkg

Sequence, based on observed residues (ATOM records): (download)

>d6bnma1 b.55.1.0 (A:219-365) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eklevleewqshiegwegsnitdtctemlmcgvllkissgniqervfflfdnllvyckrk
hrylfrgrintevmevenvddgtadfhssghivvngwkihntaknkwfvcmaktpeekhe
wfeailkererrkg

SCOPe Domain Coordinates for d6bnma1:

Click to download the PDB-style file with coordinates for d6bnma1.
(The format of our PDB-style files is described here.)

Timeline for d6bnma1:

  • d6bnma1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22

View in 3D
Domains from same chain:
(mouse over for more information)
d6bnma2