Lineage for d6e44b1 (6e44 B:15-401)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343809Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
    multihelical; bundle, contains interrupted helices
  4. 2343810Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) (S)
    contains heme-dependent enzymes
  5. 2343820Family a.266.1.2: Indoleamine 2,3-dioxygenase-like [140963] (3 proteins)
    Pfam PF01231; contains extra N-terminal all-alpha subdomain of similar fold to the GST C-terminal domain (47615)
  6. 2343830Protein automated matches [190585] (2 species)
    not a true protein
  7. 2343831Species Human (Homo sapiens) [TaxId:9606] [187592] (30 PDB entries)
  8. 3060282Domain d6e44b1: 6e44 B:15-401 [360344]
    Other proteins in same PDB: d6e44a2, d6e44b2, d6e44c2, d6e44d2
    automated match to d5wmxb_
    complexed with hem, po4

Details for d6e44b1

PDB Entry: 6e44 (more details), 1.9 Å

PDB Description: crystal structure of human indoleamine 2,3-dioxygenase 1 (ido1) free enzyme in the ferric state
PDB Compounds: (B:) Indoleamine 2,3-dioxygenase 1

SCOPe Domain Sequences for d6e44b1:

Sequence, based on SEQRES records: (download)

>d6e44b1 a.266.1.2 (B:15-401) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhltdhk
sqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlsaalelppilvyadcvlanw
kkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmqerd
tllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyegfwe
dpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcslesnp
svrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpkenktsedpskl
eakgtggtdlmnflktvrstteksllk

Sequence, based on observed residues (ATOM records): (download)

>d6e44b1 a.266.1.2 (B:15-401) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhltdhk
sqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlsaalelppilvyadcvlanw
kkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmqerd
tllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyegfwe
dpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcslesnp
svrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqleakgtggtdlmnf
lktvrstteksllk

SCOPe Domain Coordinates for d6e44b1:

Click to download the PDB-style file with coordinates for d6e44b1.
(The format of our PDB-style files is described here.)

Timeline for d6e44b1:

  • d6e44b1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-15