Lineage for d6hv1c_ (6hv1 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2312410Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2312908Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 2313086Species Listeria innocua [TaxId:1642] [47252] (5 PDB entries)
  8. 3060278Domain d6hv1c_: 6hv1 C: [360340]
    automated match to d1qgha_

Details for d6hv1c_

PDB Entry: 6hv1 (more details), 2.55 Å

PDB Description: the structure of dps from listeria innocua soaked before soaking experiments with zn, co and la
PDB Compounds: (C:) DNA protection during starvation protein

SCOPe Domain Sequences for d6hv1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hv1c_ a.25.1.1 (C:) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]}
dtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerllai
ggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegddv
tndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d6hv1c_:

Click to download the PDB-style file with coordinates for d6hv1c_.
(The format of our PDB-style files is described here.)

Timeline for d6hv1c_:

  • d6hv1c_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-15