![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
![]() | Protein automated matches [190149] (11 species) not a true protein |
![]() | Species Peptoclostridium difficile [TaxId:272563] [360251] (1 PDB entry) |
![]() | Domain d6mx2n_: 6mx2 N: [360335] automated match to d1yg6a_ complexed with gol, na |
PDB Entry: 6mx2 (more details), 2.5 Å
SCOPe Domain Sequences for d6mx2n_:
Sequence, based on SEQRES records: (download)
>d6mx2n_ c.14.1.1 (N:) automated matches {Peptoclostridium difficile [TaxId: 272563]} alvpvvveqtgrgersydifsrllkdriiflgdqvndataglivaqllfleaedpdkdih lyinspggsitsgmaiydtmqyikpdvsticigmaasmgafllaagakgkrlalpnseim ihqplggaqgqatdieihakrilkiketlneilsertgqplekikmdterdnfmsaleak eyglidevft
>d6mx2n_ c.14.1.1 (N:) automated matches {Peptoclostridium difficile [TaxId: 272563]} alvpvsydifsrllkdriiflgdqvndataglivaqllfleaedpdkdihlyinspggsi tsgmaiydtmqyikpdvsticigmaasmgafllaagakgkrlalpnseimihqplggaqg qatdieihakrilkiketlneilsertgqplekikmdterdnfmsaleakeyglidevft
Timeline for d6mx2n_: