Lineage for d6mx2n_ (6mx2 N:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435650Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2435651Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2435652Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2435832Protein automated matches [190149] (11 species)
    not a true protein
  7. 3060189Species Peptoclostridium difficile [TaxId:272563] [360251] (1 PDB entry)
  8. 3060273Domain d6mx2n_: 6mx2 N: [360335]
    automated match to d1yg6a_
    complexed with gol, na

Details for d6mx2n_

PDB Entry: 6mx2 (more details), 2.5 Å

PDB Description: crystal structure of clpp1 from clostridium difficile 630.
PDB Compounds: (N:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d6mx2n_:

Sequence, based on SEQRES records: (download)

>d6mx2n_ c.14.1.1 (N:) automated matches {Peptoclostridium difficile [TaxId: 272563]}
alvpvvveqtgrgersydifsrllkdriiflgdqvndataglivaqllfleaedpdkdih
lyinspggsitsgmaiydtmqyikpdvsticigmaasmgafllaagakgkrlalpnseim
ihqplggaqgqatdieihakrilkiketlneilsertgqplekikmdterdnfmsaleak
eyglidevft

Sequence, based on observed residues (ATOM records): (download)

>d6mx2n_ c.14.1.1 (N:) automated matches {Peptoclostridium difficile [TaxId: 272563]}
alvpvsydifsrllkdriiflgdqvndataglivaqllfleaedpdkdihlyinspggsi
tsgmaiydtmqyikpdvsticigmaasmgafllaagakgkrlalpnseimihqplggaqg
qatdieihakrilkiketlneilsertgqplekikmdterdnfmsaleakeyglidevft

SCOPe Domain Coordinates for d6mx2n_:

Click to download the PDB-style file with coordinates for d6mx2n_.
(The format of our PDB-style files is described here.)

Timeline for d6mx2n_:

  • d6mx2n_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-15