Lineage for d6mftb1 (6mft B:1-108)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (198 PDB entries)
  8. 3060267Domain d6mftb1: 6mft B:1-108 [360329]
    Other proteins in same PDB: d6mftb2, d6mftl2
    automated match to d1dn0a1
    complexed with bma, cit, edo, man, nag, peg

Details for d6mftb1

PDB Entry: 6mft (more details), 2.32 Å

PDB Description: crystal structure of glycosylated 426c hiv-1 gp120 core g459c in complex with glvrc01 a60c heavy chain
PDB Compounds: (B:) Light chain glVRC01

SCOPe Domain Sequences for d6mftb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mftb1 b.1.1.1 (B:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgtdftltisslepedfavyycqqyeffgqgtklei

SCOPe Domain Coordinates for d6mftb1:

Click to download the PDB-style file with coordinates for d6mftb1.
(The format of our PDB-style files is described here.)

Timeline for d6mftb1:

  • d6mftb1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-15

View in 3D
Domains from same chain:
(mouse over for more information)
d6mftb2