Lineage for d6hv1d_ (6hv1 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701715Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2701933Species Listeria innocua [TaxId:1642] [47252] (7 PDB entries)
  8. 2701956Domain d6hv1d_: 6hv1 D: [360323]
    automated match to d1qgha_

Details for d6hv1d_

PDB Entry: 6hv1 (more details), 2.55 Å

PDB Description: the apo structure of dps from listeria innocua before soaking experiments with zn, co and la
PDB Compounds: (D:) DNA protection during starvation protein

SCOPe Domain Sequences for d6hv1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hv1d_ a.25.1.1 (D:) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d6hv1d_:

Click to download the PDB-style file with coordinates for d6hv1d_.
(The format of our PDB-style files is described here.)

Timeline for d6hv1d_: