SCOPe 2.08: Domain d6myab2: 6mya B:330-491

Lineage for d6myab2 (6mya B:330-491)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries)

8. Domain d6myab2: 6mya B:330-491 [360318]
   Other proteins in same PDB: d6myaa1, d6myaa3, d6myab1, d6myac1, d6myad1, d6myae1, d6myae3, d6myaf1
   automated match to d4wsrd2
   complexed with edo, nag, peg

Details for d6myab2

PDB Entry: 6mya, 2.05 Å

PDB Description: crystal structure of invbp.18715.a.kn11: influenza hemagglutinin from strain a/almaty/32/1998

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6myab2:

Sequence, based on SEQRES records:

>d6myab2 h.3.1.0 (B:330-491) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqfttvgkefnnlekrmenlnkkvddgfldiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcdnecmesvrngtydypky

Sequence, based on observed residues (ATOM records):

>d6myab2 h.3.1.0 (B:330-491) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmidgwygyhhqneqyaadqkstqnaingitnkvnsviekmntqf
ttvgkefnnlekrmenlnkkvddgfldiwtynaellvllenertldfhdsnvknlyekvk
sqlknnakeigngcfefyhkcdnecmesvrngtydypky

Timeline for d6myab2:

• d6myab2 first appeared in SCOPe 2.07