Lineage for d6myaf1 (6mya F:3-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776662Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)
  8. 2776677Domain d6myaf1: 6mya F:3-324 [360306]
    Other proteins in same PDB: d6myaa2, d6myaa3, d6myab2, d6myac2, d6myad2, d6myae2, d6myae3, d6myaf2
    automated match to d4wsrd1
    complexed with edo, nag, peg

Details for d6myaf1

PDB Entry: 6mya (more details), 2.05 Å

PDB Description: crystal structure of invbp.18715.a.kn11: influenza hemagglutinin from strain a/almaty/32/1998
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d6myaf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6myaf1 b.19.1.0 (F:3-324) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dticigyhannstdtvdtlleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
llgnpecdsllparswsyivetpnsengacypgdfidyeelkeqlssvsslerfeifpke
sswpnhntlkgvtascshggkssfyrnllwltktgdsypkltnsyvnnkgkevlvlwgvh
hpsssneqqslyhnvnayvsvvssnynrrftpeiaarpkvrdqpgrmnyywtllepgdti
ifeatgnliapwyafalsrgfgssiiisnasmhecntkcqtpqgainsslpfqnihpvti
gecpkyvrstklrmvtglrnip

SCOPe Domain Coordinates for d6myaf1:

Click to download the PDB-style file with coordinates for d6myaf1.
(The format of our PDB-style files is described here.)

Timeline for d6myaf1: