Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) |
Family c.121.1.0: automated matches [191649] (1 protein) not a true family |
Protein automated matches [191196] (11 species) not a true protein |
Species Mycoplasma genitalium [TaxId:243273] [360298] (1 PDB entry) |
Domain d6mu0a1: 6mu0 A:1-151 [360299] Other proteins in same PDB: d6mu0a2 automated match to d1uslc_ complexed with 5rp |
PDB Entry: 6mu0 (more details), 1.1 Å
SCOPe Domain Sequences for d6mu0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mu0a1 c.121.1.0 (A:1-151) automated matches {Mycoplasma genitalium [TaxId: 243273]} msfnifiasdhtgltlkkiisehlktkqfnvvdlgpnyfdanddypdfaflvadkvkkns dkdlgilicgtgvgvcmaankvkgvlaalvvsektaalarqhdnanvlclssrfvtdsen ikivddflkanfeggrhqrridkiiryeket
Timeline for d6mu0a1: