Lineage for d6mu0a1 (6mu0 A:1-151)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2492997Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2492998Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2493050Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 2493051Protein automated matches [191196] (9 species)
    not a true protein
  7. 3060236Species Mycoplasma genitalium [TaxId:243273] [360298] (1 PDB entry)
  8. 3060237Domain d6mu0a1: 6mu0 A:1-151 [360299]
    Other proteins in same PDB: d6mu0a2
    automated match to d1uslc_
    complexed with 5rp

Details for d6mu0a1

PDB Entry: 6mu0 (more details), 1.1 Å

PDB Description: crystal structure of ribose-5-phosphate isomerase b from mycoplasma genitalium with bound ribulose-5-phosphate
PDB Compounds: (A:) Probable ribose-5-phosphate isomerase B

SCOPe Domain Sequences for d6mu0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mu0a1 c.121.1.0 (A:1-151) automated matches {Mycoplasma genitalium [TaxId: 243273]}
msfnifiasdhtgltlkkiisehlktkqfnvvdlgpnyfdanddypdfaflvadkvkkns
dkdlgilicgtgvgvcmaankvkgvlaalvvsektaalarqhdnanvlclssrfvtdsen
ikivddflkanfeggrhqrridkiiryeket

SCOPe Domain Coordinates for d6mu0a1:

Click to download the PDB-style file with coordinates for d6mu0a1.
(The format of our PDB-style files is described here.)

Timeline for d6mu0a1:

  • d6mu0a1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-15

View in 3D
Domains from same chain:
(mouse over for more information)
d6mu0a2