Lineage for d1rgeb_ (1rge B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 251696Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 251697Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 251698Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)
  6. 251808Protein RNase Sa [53935] (1 species)
  7. 251809Species Streptomyces aureofaciens [TaxId:1894] [53936] (16 PDB entries)
  8. 251813Domain d1rgeb_: 1rge B: [36029]
    complexed with 2gp, so4

Details for d1rgeb_

PDB Entry: 1rge (more details), 1.15 Å

PDB Description: hydrolase, guanyloribonuclease

SCOP Domain Sequences for d1rgeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgeb_ d.1.1.2 (B:) RNase Sa {Streptomyces aureofaciens}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

SCOP Domain Coordinates for d1rgeb_:

Click to download the PDB-style file with coordinates for d1rgeb_.
(The format of our PDB-style files is described here.)

Timeline for d1rgeb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rgea_